Las hipótesis de Oparin y el experimento de Stanley Miller

Las hipótesis de Oparin y el experimento de Stanley Miller


Al abordar la cuestión del origen de la vida en la tierra resulta inevitable referirse al científico soviético Alexander Ivanovich Oparin.

Según Oparin, las condiciones existentes en los primeros tiempos de la historia de la Tierra, una atmósfera rica en hidrógeno, metano, amoníaco y vapor de agua, bombardeada constantemente por los rayos solares ricos en ultravioleta (entonces aún no existía la capa de ozono) y por las descargas eléctricas producidas durante las tormentas, hicieron posible la síntesis de multitud de moléculas orgánicas que cayeron en los océanos formando un “caldo” o “sopa nutritiva”, donde se fue acumulando.

La mayor o menor afinidad entre estas moléculas hizo que se fuesen asociando para crear estructuras más complejas en forma de esferas microscópicas huecas llamadas “coacervados”. Con el tiempo, se fueron autoseleccionando y sobrevivieron las que tenían capacidad autorreplicativa, que constituirían las primeras células.

Aunque nos pueda parecer un hecho imposible, hemos de tener en cuenta el factor tiempo, afirman los evolucionistas

No se sabe cuándo ni cómo estos coacervados pasaron a constituir un verdadero organismo. Probablemente, durante miles o millones de años se fueron seleccionando y perfeccionando para convertirse en las primeras “protocélulas”.

Una hipótesis tan rotunda debería ser demostrada.

Fue el químico norteamericano Stanley L. Miller (1930-2007) quien demostró junto a Harold Urey (1893-1981), siendo aún un estudiante universitario, que las ideas de Oparin eran acertadas, o al menos podían ser plausibles. En una experiencia que reproducía las condiciones de la atmósfera primitiva y la radiación de hace 4 000 millones de años, obtuvo compuestos orgánicos a partir de una mezcla inicial de compuestos inorgánicos.

Así demostró que la materia orgánica podía aparecer espontáneamente a partir de la inorgánica en las condiciones adecuadas.

La experiencia consistió en hacer circular una mezcla gaseosa con esa composición a través de un aparato cerrado. En otra ampolla había agua hirviendo. Se sometió a los gases a una descarga eléctrica producida por una chispa de electrodos de tungsteno. A continuación se condensó la mezcla gaseosa y se añadió al agua hirviendo para su recirculación. Todos los compuestos no volátiles que se hubiesen formado se acumularían en el agua. Se hizo trabajar el aparato durante una semana.

Como resultado se obtuvo la síntesis de varios aminoácidos como alanina, glicina, ácido glutámico y ácido aspártico y otros compuestos orgánicos.

Los científicos repitieron estos experimentos y obtuvieron también purinas, pirimidinas, azúcares y 18 de los 20 aminoácidos esenciales para la vida. También se obtuvieron polímeros como polipéptidos en condiciones prebióticas.

Estos compuestos prebióticos se sabe que no son exclusivos de la Tierra, por técnicas radioastronómicas se han detectado compuestos orgánicos relativamente sencillos en las nubes de polvo interestelar.

Los tres primeros encontrados son intermediarios muy importantes para la síntesis prebiótica como el formaldehído del cual se originan azúcares; el ácido cianhídrico de los que se obtienen aminoácidos y adenina y el cianoacetileno del cual derivan bases pirimídicas.

Sin embargo, el experimento de Miller no es mas que un argumento circular, crearon las condiciones ideales para producir aminoacidos, sin evidencia alguna asumieron que la atmosfera primitiva era reductora, hoy sabemos que habia oxigeno por evidencia geologica abrumadora, los aminoacidos que obtuvo fue una mezcla racemica de L y D, solo aminoacidos L pueden conformar una proteina biologicamente funcional, en fin, que se puede decir de este experimento que algunos consideran la validacion de Oparin.

Harold Urey que era el tutor de la tesis doctoral de Stanley Miller, no quizo hacer el experimento, no queria dañar su prestigio academico, usó a Stanley Miller que era su estudiante de Doctorado para crear alguna clase de experimento que proveyera evidencia a las propuestas descabelladas de Alexander Oparin, este experimento solo tomó como 6 dias, la “trampa” consiste en la circularidad , o sea era 100% predecible bajo esas circunstancias que iban a obtener esos aminoacidos, lo otro fue asumir como certeza que la atmosfera prebiotica era reductora con metano y amonia .

Desgraciadamente muchos creen que este experimento valida las absurdas propuestas de Alexander Oparin. El mismo dr. Crick, el nobel del ADN, no pudo creer que la vida era producto de casualidad.

Se dice que Urey y Miller comprobaron que las ideas de Oparin eran viables. Para ello diseñaron un experimento donde recrearon supuesta mente las condiciones de la vida primigenia o sopa orgánica.

El problema es que, tales compuestos son destruidos ni bien aparecen por las cargas eléctricas que los sintetizaron. Por lo tanto, el experimento de Urey y Miller tenía en el fondo del frasco donde se creaba la presunta sopa orgánica y que Carl Sagan tanto ponderaba en su serie Cosmos, una trampa por donde se retiraban de inmediato, los compuestos orgánicos para que no fueran destruidos.

Por eso este experimento fue un fiasco, pero pocos evolucionistas lo declaran hoy en día. Si en el principio evolucionista de todas las cosas, los rayos atmosféricos o solares o estelares dieron origen a los compuestos orgánicos ¿como evitaron estos la destrucción sin la ayuda de nadie?

Esa es la famosa trampa que inhabilito las ideas de Oparin al cual aun hoy, se lo considera alguien muy importante  en la ciencia evolucionista,  aun cuando sus ideas resultaron inviables en experimentos.

Fuentes bibliograficas:

Anuncios

El origen de la vida en el pensamiento antiguo

El origen de la vida en el pensamiento antiguo


Publicado por Javier García Calleja el 26 de Noviembre de 2009

Desde el principio de los tiempos, los seres humanos nos hemos preguntado cuál es nuestro ori gen y cómo pudo ocurrir la transición de la materia inerte al ser vivo en los inicios del planeta.

Desde los inicios del pensamiento transcendente, probablemente con los neandertales,se han relacionado los elementos terrestres con la vida, con mayor o menor impli cación divina.

Este pensamiento de desarrollo profundamente, y ha llegado hasta nosotros, procedente especialmente  de las civilizaciones antiguas:

Un mito griego habla de la capacidad fertilizadora del viento; otros sugieren que todas las criatu ras nacieron en el océano o que la madre Tierra produjo hierbas, flores, árboles y animales ferti lizados por la lluvia de Urano. El Talmud hebreo nos habla de la creación del hombre a partir del polvo; la Biblia, del barro.

Es decir, el ser humano siempre ha relacionado el origen de la vida y el planeta que lo sustenta.

Cuando la ciencia se comenzó a organizar y sistematizar, esta idea se plasmó en lateoría de la generación espontánea, que afirmaba que los seres vivos nacían de for ma espontánea de la materia orgánica en descomposición, incluso de la materia inorgánica. Sus defensores creían que los gusanos nacían del suelo; las ratas, de la basura, y las moscas, de los ali mentos en descomposición.image

El primer intento para derrotar esta teoría lo protagonizó Francesco Redi (1626-1697), quien llevó a cabo un experimento consistente en dejar unos trozos de carne en unos frascos: cerró uno con pergamino; otro, con gasa y dejó un tercero destapado. Al cabo de unos días, comprobó que había gusanos en el frasco abierto, pero no en los cerrados. Una observación demostraba la teoría de la generación espontánea, pero la otra la contradecía.

Redi concluyó que los gusanos procedían de los huevos que las moscas habían depositado sobre la carne, y no aparecían en los frascos cerrados por la imposibilidad de que las mos cas entrasen en ellos.

image

Aun después de este experimento, siguió la polémica sobre una teoría que había llegado a convencer a científicos como Aristóteles, Descar tes o Newton, y fueron muchos los que intenta ron demostrar con experiencias su validez.image

La controversia quedó definitivamente solucionada cuando Louis Pasteur (1822-1895)  llevó a cabo un experimento con el que ganó un premio de la Academia de las Ciencias de París, en 1862. Su expe­riencia consistió en introducir un caldo de carne en distintos matraces, los cuales tapó con un tubo hue co doblado en forma de S, de manera que el aire pudiera salir y cualquier microorganismo que entra se quedaría en la parte cóncava del tubo. Hirvió ambos compuestos y comprobó que ninguno de los caldos se contaminaba con el paso del tiempo. A continuación, cortó el tubo de uno de los matraces dejándolo descubierto y observó que era ese el que, en poco tiempo, resultaba colonizado por multi tud de organismos vivos. La teoría de la generación espontánea quedaba, así, totalmente invalidada.

copìado de http://biologia.laguia2000.com/biologia/el-origen-de-la-vida-en-el-pensamiento-antiguo

Sobre el tema de la Abiogénesis

Sobre el tema de la Abiogénesis

No necesariamente este artículo refleja la opinión del administrador del blog, que profesa la creencia creacionista. Lo posteo a fin de ser evaluado, debatido,y recibir todos aquellos aportes de personas entendidas en el tema.

Este artículo, es una ampliación del tema ingresado bajo el título Lo mucho que debemos a los cometas.


Introducción.

Bastante a menudo alguien viene con la afirmación “la formación de cualquier enzima por azar es casi imposible, por lo tanto la abiogénesis es imposible”. A menudo se cita un impresionante calculo del astrofísico Fred Hoyle, o sacan a relucir la llamada “Ley de Borel” para probar que la vida es estadísticamente imposible. Estas personas, incluído Fred, han cometido uno o más de los siguientes errores.

Glosario

Acriltransferasa:
Una enzima o ribosoma que sintetiza péptidos.
Ligasa:
Una enzima o ribosoma que agrega un monómero a un polímero, o enlaza dos polímeros cortos.
Monómero:
Cualquier subunidad simple de un polímero. Un aminoácido es un monómero de un péptido o proteína, un nucleótido es un monómero de un oligonucleótido o polinucleótido.
Nucleótido:
Adeína, Guanina, Citocína y Uranina. Estos son los monómeros que componen los oligo/polinucleótidos tal como el ARN.
Oligonucleótido:
Un polímero corto de subunidades de nucleótidos.
Polimerasa:
Una enzima o ribosoma que hace un polímero fuera de los monómeros. Por ejemplo, el polimerasa ARN hace al ARN salir de simples nucleótidos.
Ribosomas:
Un atalizador biológico hecho desde el ARN.
Autorreplicante:
Una molecula que puede hacer identicas o casi identicas copias de sí misma a partir de pequeñas subunidades. Se conocen al menos cuatro autorreplicantes.

Problemas con los caulculos creacionistas “tan improbables”.

1) Calculan la probabilidad de la formación de una proteína “moderna” o aún peor una bacteria completa con todas sus proteínas “modernas”, por eventos aleatorios. Esto no es la teoría del abiogénesis de ninguna manera.

2) Asumen que la vida requiere un número fijo de proteínas con sequencias fijas para cada proteína.

3) Calculan la probabilidad como intentos secuenciales en vez de intentos simultaneos.

4) Malinterpretan que es lo que se entiende por calculo deprobabilidades.

5) Sobreestiman seriamente el número de enzimas/ribozomas presentes en un grupo de sequencias aleatorias.

Trataré y les llevaré a través de estos errores, y les mostraré por qué no es posible hacer un calculo de “probabilidad de abiogénesis” de ninguna manera.

Un globulo protoplásmico primordial.

Asi que el calculo es acerca de la probabilidad de la formación de 300 proteínas de aminoácidos largos (esto es, enzimas como la carbonoxipeptidasa) dados aleatoriamente es (1/20)300 o 1 posibilidad en 2.04 x 10390, que es asombrosa y extremadamente improbable. Esto adicionado a la probabilidad de generar 400 o más enzimas similares hasta que se alcanza una figura tan grande que el solo hecho de contemplarla causa que tu cerebro comience a salirse por las orejas. Esto dá la impresión de que la formación del más pequeño organismo parezca totalmente imposible. Sin embargo, esto es completamente incorrecto.

Primeramente, la formación de polímeros biológicos desde monómeros es una función de las leyes de la química y la bioquímica, y estas definitivamente no son aleatorias.

En segundas, toda la premisa es incorrecta desde el principio, porque en las modernas teorías del abiogénesis la primera “cosa viviente” sería mucho más simple, ni siquiera una protobacteria o una preprotobacteria (lo que Oparin llamaba un protobionte, y Woese llama un protogenote), sino que una o más moleculas simple probablemente no más largas que de 30 o 40 subunidades. Estas simples moleculas luego evolucionaron en sistemas cooperativos autoreplicantes, y finalmente en organismos simples. La siguiente ilustración es una camparación entre un protobionte hipotetico y una bacteria moderna.

[Ur Cell figure]

La primera “cosa viviente” podría haber sido una simple molecula autoreplicante, similar a los péptidos “autorreplicantes” del grupo de Ghadiri, o los hexanucleótidos autorreplicantes, o prosiblemente un polímero de ARN que actua sobre sí mismo.

[Self-replicator figure]

Otra visión es que los primeros autorreplicantes fueron grupos de catalizadores, ya sean enzimas protéicas o ribozomas de ARN, estos se regeneraron a sí mismos como un ciclo catalítico. Un ejemplo es la subunidad autorreplicante SunY tres. Estos ciclos catalíticos podrían estar limitados a un charco pequeño o laguna, o ser un complejo catalítico absorbido ya sea por arcilla o material lípido en la arcilla. Dado que hay muchas secuencias catalíticas en un grupo de peptidos o polinucleótidos aleatorios no es improbable que se formara un pequeño complejo catalítico.

Los dos modelos no son mutuamente excluyentes. Los peptidos Ghadiri pueden mutar y formar ciclos catalíticos.

No interesa si los primeros autorreplicantes fueron moleculas simples o complejo de moleculas simples, este modelo no tiene nada que ver con el tornado de Hoyle pasando por un basurero para formar un 747. Solo para establecer el punto, aquí está una comparación simple de la teoría que es criticada por los creacionistas y la actual teoría de la abiogénesis.

[Dos visiones de la abiogénesis]

Notar que la teoría real tiene un número de pequeños pasos intermédios, y, de hecho, he dejado algunos afuera (especialmente entre los estados de hiperciclos y protobiontes) para simplificar. Cada paso está asociado a un pequeño incremento en la organización y la complejidad, y los elementos químicos ascienden hacia lo organico en vez de dar un gran salto.

De dónde los creacionistas sacaron que los modernos organismos aparecieron espontaneamente es incierto. La primera formulación moderna del abiogénesis, la hipótesis Oparin / Haldane de los años ’20, comienza con proteínas / proteinoides simples desarrollandose lentamente en celulas. Incluso las ideas que circulaban de 1850 no fueron teorías de “espontaneidad”. ¡Lo más lejano que pude ir es a las ideas originales de Lamarck de 1803!.

Dado que los creacionistas han estado criticando una teoría de hace 150 años que ningún biólogo moderno sostiene, para ¿qué ir más lejos? Porque hay problemas fundamentales en las estadísticas y la bioquímica que aparecen en estas “refutaciones” erradas.

El mito de la “secuencia de la vida”.

A veces se escucha otra pretención, que hay una “secuencia de la vida” de 400 proteínas, y que las secuencias de aminoácidos de esas proteínas no pueden ser cambiadas, para que los organismos estén vivos.

Esto, sin embargo, son disparates. La pretención de las 400 proteínas parece venir del genoma codificado de proteínas delMycobacterium genetalium, el cual tiene el genoma más pequeño actualmente conocido para un organismo moderno. Sin embargo las inspecciones del genoma sugieren que podrían estar reducidas aún más hasta un conjunto mínimo de genes de 256 proteínas. Notar otra vez que esto es un organismo moderno. El primer protobionte / progenote prodría haber sido aún más pequeño, y estar precedido por aún mas simples sistemas químicos.

Para la pretención de que la secuencia de proteínas no puede ser cambiada, otra vez, esto es un disparate. Hay en la mayoría de las regiones de las proteínas donde casi cualquier aminoácido puede ser substituido, y otras regiones donde las substituciones conservadoras pueden ser hechas (donde los aminoácidos cambiados pueden serlo con otros aminoácidos, neutrales por otros aminoácidos neutrales, aminoácidos hidrofóbicos por otros aminoácidos hidrofóbicos). Algunas moleculas funcionalmente equivalentes pueden tener diferencias entre 30 y 50 % en sus aminoácidos. De hecho es posible sustituir proteínas bacterianas no identicas estructuralmente por proteínas de levadura y proteínas de gusanos por proteínas humanas y el organismo felizmente seguiría vivo.

La “secuencia de la vida” es un mito.

Lanzamiento de monedas para principiantes y ensamble macromolecular.

Asi que juguemos al juego creacionista y miremos la formación de péptidos por suma aleatoria de aminoácidos. Ciertamente esta no es la forma en que los péptidos se formaron en la Tierra temprana pero será instructivo.

Usaré como ejemplo el péptido “autorreplicante” del grupo Ghadiri mencionado más arriba. Podría usar otros ejemplos, tal como el autorreplicante hexanucleótido, el autorreplicante SunY o el polimerasa ARN descripto por el grupo Eckland, pero para continuar con la historia de las pretenciones creacionistas un péptido pequeño es lo ideal. Este péptido tiene un largo de 32 aminoácidos con la secuencia de RMKQLEEKVYELLSKVACLEYEVARLKKVGE y es una enzima, un ligasa péptido que hace una copia de sí mismo de dos subunidades de 16 aminoácidos de longitud. Es además del tamaño y composición que es ideal para ser formado por sintesis abiótica de péptidos. El hecho de que es un autorreplicante es una ironía agregada.

La probabilidad de generar esto en sucesivos intentos aleatorios es (1/20)32 o 1 en 4.29 x 1040. Esto es mucho, mucho mas probable que 1 en 2.04 x 10390 del escenario creacionista estandar de “generar carboxypeptidasa por azar”, pero aún es absurdamente bajo.

Sin embargo, hay otro lado en estas estimaciones probabilísticas, y depende del hecho de que la mayoría de nosotros no tenemos noción de las estadísticas. Cuando alguien nos dice que algún evento tiene una chance en un millón de ocurrir, muchos de nosotros esperamos que se hagan un millon de intentos antes de decir que el evento apareció. Pero esto es incorrecto.

Aquí tienes un experimento que puedes hacer tú mismo: toma una moneda arrojala cuatro veces, escribe los resultados y hazlo de nuevo. ¿Cuántas veces piensas que tendrás que repetir este procedimiento (intento) antes de obtener 4 caras en una sola tanda?

La probabilidad de tener 4 caras en una tanda es ahora de (1/2)4 o 1 chance en 16: ¿tenemos que hacer 16 intentos para obtener 4 caras (CCCC)? no, en experimentos sucesivos obtuve 11, 10, 6, 16, 1, 5, y 3 intentos antes de que CCCC apareciera. La figura 1 en 16 (o 1 en un millón o 1 en 1040) da la probabilidad de un evento en un intento dado, pero no dice cuándo ocurrirá en una serie. Puedes obtener CCCC justo en el primer intento (yo lo conseguí). Aún en una chance en 4.29 x 1040, un autorreplicante podría aparecer sorprendentemente temprano. Pero aún hay más.

Una chance en 4.29 x 1040 aún es asquerosamente inverosimil. Es difícil manejar este número. Aún con el argumento de arriba (podrías obtenerlo en el primer intento) la mayoría de la gente diría “seguramente tomaría mas tiempo que el que la Tierra ha existido hasta obtener este replicador por métodos al azar”. No, realmente. En el ejemplo de arriba estabamos examinando intentos secuenciales (uno detrás del otro), como si hubiera una sola proteína / ADN / proto-replicador siendo ensamblado en cada intento. La verdad es que habría millones de millones de intentos simultaneos como los millones de millones de moléculas en bloque trabajaron recíprocamente en los océanos, o en los miles de kilómetros de costas que pudieron proveer superficies catalíticas o moldes.

Volvamos a nuestro ejemplo con las monedas. Digamos que se toma un minuto en lanzar la moneda 4 veces; para generar CCCC tomará en promedio 8 minutos. Ahora consigue 16 amigos, cada uno con una moneda, para que todos lancen las suyas 4 veces simultaneamente; el promedio de tiempo para generar CCCC es ahora un minuto. Ahora traten de conseguir 6 caras en una tanda, esto tiene la probabilidad de (1/2)6 o 1 en 64. Esto tomaría una media hora en promedio, pero salgan y consigan 64 personas, y ahora vuelven a tener 1 minuto de tiempo promedio. Si quieres obtener una secuencia con una chance de 1 en mil millones, solamente recluta a la población de China para que lancen monedas para tí y tendrás esa secuencia en practicamente nada de tiempo.

Asi que si en nuestra Tierra prebiótica tenemos mil millones de peptidos creciendo simultaneamente, eso reduce el tiempo para generar nuestro replicador muy significativamente.

Ok, estas mirando ese número otra vez, una chance en 4.29 x 1040, ese es un número MUY grande, y si bién mil millones de moleculas primordiales son muchas moleculas, ¿podríamos obtener alguna vez suficientes moleculas para ensamblar aleatoriamente nuesto primer replicador en menos de la mitad de mil millones de años?

Sí, por supuesto, un kilogramo de aminoácido tiene 2.85 x 1024 moleculas en él (esto es más de un billón); una tonelada tiene 2.85 x 1027 moleculas. Si tomaramos un semiremolque cargado de cada uno de los aminoácidos y los tiramos en el medio de un lago tendrías suficientes moleculas como para generar nuestro replicador en particular en menos de 10 años, dado que puedes hacer 55 proteínas de aminoácidos largos en una o dos semanas.

Entonces, ¿cómo encaja esto en la Tierra prebiótica? En la Tierra temprana es probable que los oceanos hallan tenido un volumen de 1 x 1024 litros. Dada una concentración de aminoácidos de 1 x 10-6 M (una sopa moderadamente diluida, ver Chyba y Sagan 1992) hay aproximadamente 1 x 1050 potenciales cadenas primigenias, asi que un número razonable de ligasa péptidos eficientes (alrededor de 1 x 1031) se podrían producir en casi un año, dejenlos solos un millón de años… La sintesis de autorreplicantes primitivos podría suceder relativamente rápido, aún dada la probabilidad de 1 chance en 4.29 x 1040 (y recuerda, nuestro replicador podría ser sintetizado justo en el primer intento).

Asume que toma una semana en generar una secuencia. Entonces el ligasa Ghadiri podría generarse en una semana, y cualquier secuencia citocroma C podría generarse en apenas un millón de años (junto con alrededor de la mitad de todas las secuencias de peptidos posibles, una gran proporción de las cuales serán proteínas funcionales de algún tipo).

Si bién he usado la ligasa Ghadini como un ejemplo, como mencioné más arriba los mismos calculos pueden ser hechos para los autorreplicantes SunY, los polimerasas de ARN de Eckland. Dejo esto como ejercicios para el lector, pero en general la conclusión es la misma para estos oligonucleótidos.

Espacios de busqueda, o ¿cuántas agujas hay en un pajar?

Así, he mostrado que generar una pequeña enzima cualquiera no es extremadamente difícil como los creacionistas (y Fred Hoyle) sugieren. Otra malainterpretación es que la mayoría de la gente cree que el número de enzimas / ribosomas, dejando de lado los polimerasas de ARN o cualquier forma de autorreplicantes, representa una configuración muy inverosimil y que las chances para que una simple formación de enzimas / ribosomas, dejando de lado el número de ellos, desde una suma aleatoria de acidos / nucleótidos es muy pequeña.

Sin embargo, un análisis hecho por Eckland sugiere que en el espacio de secuencia de 220 nucleótidos de ARN largos, 2.5 x 10112 secuencias son ligasas eficientes. No está mal para un compuesto previamente pensado para ser solo estructural. Volviendo a nuestro oceano primitivo de 1 x 1024 litros y asumiendo una concentración de nucleótidos de 1 x 10-7 M, entonces hay mas o menos 1 x 1049 cadenas de potenciales nucleótidos, asi que un número razonable de ligasas de ARN eficientes (alrededor de 1 x 1034) podrían ser producidas en un año, dejenlas solas un millón de años… El potencial número de polimerasas de ARN es además, alto, alrededor de 1 en cada 1025 secuencias es una polimerasa de ARN. Consideraciones similares se aplican para las transferasa acrilribosomicas (alrededor de 1 por cada 1015 secuencias), y para las sintesis de nucleótidos ribosomicas.

Asi que, aún con más números realísticos, el ensamblaje aleatorio de aminoácidos en sistemas con “soporte de vida”, parecería ser bastante factible, aún con los números más pesimistas para la concentración de monómeros original y el tiempo de sintesis.

Conclusiones.

La gran premisa de los calculos de probabilidad de los creacionistas es incorrecta en primer lugar porque se basa en la teoría incorrecta. Más aún, este argumento a veces está contaminado con falacias estadísticas y biológicas.

En este momento, desde que no tenemos idea de cuán probable es la vida, es virtualmente imposible asignar probabilidades significativas a ninguno de los pasos de la vida excepto a los primeros dos (monomeros a polímeros p=1.0, formación de polímeros catalíticos p=1.0). Para los polímeros replicantes a la transición de hiperciclo la probabilidad bién puede ser 1.0 siKauffman tiene razón acerca del “cierre catalítico” en sus modelos de transición de fase, pero esto requiere química real y modelación más detallada para confirmarlo. Para la transición hiperciclo -> protobionte, la probabilidad es dependiente de conceptos teóricos que aún están siendo desarrollados y es desconocido.

Sin embargo, al final, la factibilidad de la vida depende de la química y la bioquímica que siguen siendo estudiadas, y no lanzando monedas al aire precisamente.

Referencias (en inglés).

[1] Unrau PJ, and Bartel DP, RNA-catalysed nucleotide synthesis. Nature, 395: 260-3, 1998

[2] Orgel LE, Polymerization on the rocks: theoretical introduction. Orig Life Evol Biosph, 28: 227-34, 1998

[3] Otsuka J and Nozawa Y. Self-reproducing system can behave as Maxwell’s demon: theoretical illustration under prebiotic conditions. J Theor Biol, 194, 205-221, 1998

[4] Woese C, The universal ancestor. Proc Natl Acad Sci USA, 95: 6854-6859.

[5] Varetto L, Studying artificial life with a molecular automaton. J Theor Biol, 193: 257-85, 1998

[6] Wiegand TW, Janssen RC, and Eaton BE, Selection of RNA amide synthases. Chem Biol, 4: 675-83, 1997

[7] Severin K, Lee DH, Kennan AJ, and Ghadiri MR, A synthetic peptide ligase. Nature, 389: 706-9, 1997

[8] Ruse M, The origin of life, philosophical perspectives. J Theor Biol, 187: 473-482, 1997

[9] Lee DH, Severin K, Yokobayashi Y, and Ghadiri MR, Emergence of symbiosis in peptide self-replication through a hypercyclic network. Nature, 390: 591-4, 1997

[10] Lee DH, Severin K, and Ghadri MR. Autocatalytic networks: the transition from molecular self-replication to molecular ecosystems. Curr Opinion Chem Biol, 1, 491-496, 1997

[11] Di Giulio M, On the RNA world: evidence in favor of an early ribonucleopeptide world. J Mol Evol, 45: 571-8, 1997

[12] Ekland EH, and Bartel DP, RNA-catalysed RNA polymerization using nucleoside triphosphates. Nature, 383: 192, 1996

[13] Lohse PA, and Szostak JW, Ribozyme-catalysed amino-acid transfer reactions. Nature, 381: 442-4, 1996

[14] Ferris JP, Hill AR Jr, Liu R, and Orgel LE, Synthesis of long prebiotic oligomers on mineral surfaces [see comments]. Nature, 381: 59-61, 1996

[15] Lazcano A, and Miller SL, The origin and early evolution of life: prebiotic chemistry, the pre- RNA world, and time. Cell, 85: 793-8, 1996

[16] Ertem G, and Ferris JP, Synthesis of RNA oligomers on heterogeneous templates. Nature, 379: 238-40, 1996

[17] Lee DH, Granja JR, Martinez JA, Severin K, and Ghadri MR, A self-replicating peptide. Nature, 382: 525-8, 1996

[18] Joyce GF, Building the RNA world. Ribozymes. Curr Biol, 6: 965-7, 1996

[19] Ishizaka M, Ohshima Y, and Tani T, Isolation of active ribozymes from an RNA pool of random sequences using an anchored substrate RNA. Biochem Biophys Res Commun, 214: 403-9, 1995

[20] Mushegian AR and Koonin, EV, A minimal gene set for cellular life derived by comparison of complete bacterial genomes.Proc. Natl. Acad. Sci. USA, 93: 10268-10273.

[21] Ekland EH, Szostak JW, and Bartel DP, Structurally complex and highly active RNA ligases derived from random RNA sequences. Science, 269: 364-70, 1995

[22] Breaker RR, and Joyce GF, Emergence of a replicating species from an in vitro RNA evolution reaction.Proc Natl Acad Sci U S A, 91: 6093-7, 1994

[23] Chyba C and Sagan C, Endogenous production, exogenous delivery and impact-shock synthesis of organic molecules: an inventory for the origins of life. Nature, 355: 125-32., 1992

[24] Doudna JA, Couture S, and Szostak JW, A multisubunit ribozyme that is a catalyst of and template for complementary strand RNA synthesis. Science, 251: 1605-8, 1991

[25] Lahav N, Prebiotic co-evolution of self-replication and translation or RNA world? J Theor Biol, 151: 531-9, 1991

[26] Stadler PF, Dynamics of autocatalytic reaction networks. IV: Inhomogeneous replicator networks. Biosystems, 26: 1-19, 1991

[27] Eigen M, Gardiner W, Schuster P, and Winkler-Oswatitsch R, The origin of genetic information. Sci Am, 244: 88-92, 96, et passim, 1981

[28] Eigen M, and Schuster P, The hypercycle. A principle of natural self-organization. Springer-Verlag, isbn 3-540-09293, 1979

[29] Yockey HP, On the information content of cytochrome c. J Theor Biol, 67: 345-76, 1977

Libros utiles (en inglés).

Statistics at Square One, T.D.V. Swinscow, 8th Edition Paperback, Published by Amer College of Physicians, 1983, ISBN: 0727901753

Evolution from Space, F Hoyle and Wickramasinghe, JM Dent and sons, London, 1981

Vital Dust: Life As a Cosmic Imperative, by Christian De Duve, Basic Books 1995, ISBN: 0465090451

The Major Transitions in Evolution, Maynard Smith J & Szathmary E, 1995, WH Freeman, ISBN: 0716745259

The Origins of Order: Self Organization and Selection in Evolution. By Stuart Kauffman, S. A. (1993) Oxford University Press, NY, ISBN: 0195079515.

At Home in the Universe. By Stuart Kauffman, 1995) Oxford University Press, NY.

Links (en inglés).

Agradecimientos.

Gracias a John Wilkins y Jthomford por la valiosa ayuda, sugerencias y discusiones. Gracias a John por los buenos GIFs y JPEGS.

Fuente:Mentiras, malditas mentiras, Estadísticas y la Probabilidad de los cálculos de la Abiogénesis,por Ian Musgrave,Copyright © Diciembre 1998,Adaptado y traducido por Diego Romero (Driver_Op),El documento original puede ser encontrado aquí,http://www.driverop.com.ar/abioprob.php)

Origen de la vida: Teorías científicas a través del pensamiento científico.