Los mamíferos invaden la Gran Manzana

Los mamíferos invaden la Gran Manzana

Quien dude de la existencia de “fósiles de transición” que se acerque a esta exposición

especie intermedia

El Mundo Digital

En la era de los dinosaurios, los mamíferos eran un puñado de animalillos asustadizos y esquivos, especialmente equipados para funcionar de noche, cuando los temibles depredadores dormían. «Hace 50 millones de años, tras la extinción de los grandes saurios, los mamíferos empezaron a crecer, a diversificarse y a adaptarse de una manera insospechada a las condiciones extremas de la naturaleza».

Las palabras del paleontólogo Michael Novacek son apenas un presagio de lo que nos espera en las penumbras del Museo de Historia Natural de Nueva York. Nada más cruzar el umbral que anuncia la llegada de los «mamíferos extremos», nos topamos con la mole del Indricotherium, a medio camino entre el rinoceronte y el elefante, pero cuatro veces más grande que éste.

El mayor mamífero terrestre del que se tiene noticia -estrictamente vegetariano, pese a sus 20 toneladas- llegó a vivir en los bosques de Asia central hasta hace unos 34 millones de años. Los humanos, que encajan también en el molde de extremos por su empeño en caminar sobre dos pies, pueden pasar tranquilamente bajo la panza de su pariente lejano sin bajar la cabeza.

En el Museo de Historia Natural se le puede tomar también la medida alBatonoides, el mamífero más minúsculo que jamás hubo sobre la faz de la Tierra, pero la tendencia natural es hacia lo grande, hasta llegar por supuesto a la ballena azul del Antártico (2.000 ejemplares quedan), 20 veces mayor que el Indricotherium y con una lengua que pesa cuatro toneladas.

Especies desaparecidas

La aventura de los mamíferos -vagamente unidos por el desarrollo del cerebro, la sangre caliente, el pelo en el cuerpo y la capacidad de producir leche- arranca más o menos hace 200 millones de años. El ornitorrinco y el koala, de la tribu de los marsupiales, son descendientes más o menos directos de ese tronco increíblemente diverso y con ramificaciones en tierra, mar y aire. Ahí están los primeros murciélagos, y las ballenas con patas, y elRepenomamus, posiblemente el primer mamífero del período Cretácico que se atrevió a hincar el diente a los dinosaurios más pequeños.

Veremos luego el esqueleto de un Uintaterium, con sus cuernos múltiples, extinguido hace 40 millones de años. Mucho más cercana, la ‘macrauchenia’ o cuello largo (una especie de llama gigante y con trompa), resucita al cabo de 10.000 años.

Al tigre de dientes de sable (Smilodon fatalis) ya le conocíamos por las películas, pero poco sabíamos hasta ahora de su temible pariente entre los marsupiales, el Thylacosmilus Atrox, o de ese extraño cruce entre armadillo y tanque, el Glyptodon, o del más voluminoso represetante de la familia de los perezosos, el Glossotherim myloides, que medía seis metros y llegaba a las 10 toneladas.

Australia, Madagascar o la paradisíaca isla de Ellesmere en el Ártico (antes de la última glaciación) encierran la clave de esa fascinante evolución de la que sólo quedan unos cuantos vestigios ante nuestros ojos. Hoy por hoy existen apenas 5.400 especies cercanas y el 99% de los mamíferos ya no están con nosotros.

El lobo de Tasmania, extinto en 1936 por el afán depredador del hombre, es tal vez el más trágico recordatorio. Al acecho, entre las especies amenazadas, nos despiden el lince ibérico, la marmota de Vancouver y el rinoceronte de Sumatra.

Visto en oldearh.wordpress.com

Anuncios

Sobre el tema de la Abiogénesis

Sobre el tema de la Abiogénesis

No necesariamente este artículo refleja la opinión del administrador del blog, que profesa la creencia creacionista. Lo posteo a fin de ser evaluado, debatido,y recibir todos aquellos aportes de personas entendidas en el tema.

Este artículo, es una ampliación del tema ingresado bajo el título Lo mucho que debemos a los cometas.


Introducción.

Bastante a menudo alguien viene con la afirmación “la formación de cualquier enzima por azar es casi imposible, por lo tanto la abiogénesis es imposible”. A menudo se cita un impresionante calculo del astrofísico Fred Hoyle, o sacan a relucir la llamada “Ley de Borel” para probar que la vida es estadísticamente imposible. Estas personas, incluído Fred, han cometido uno o más de los siguientes errores.

Glosario

Acriltransferasa:
Una enzima o ribosoma que sintetiza péptidos.
Ligasa:
Una enzima o ribosoma que agrega un monómero a un polímero, o enlaza dos polímeros cortos.
Monómero:
Cualquier subunidad simple de un polímero. Un aminoácido es un monómero de un péptido o proteína, un nucleótido es un monómero de un oligonucleótido o polinucleótido.
Nucleótido:
Adeína, Guanina, Citocína y Uranina. Estos son los monómeros que componen los oligo/polinucleótidos tal como el ARN.
Oligonucleótido:
Un polímero corto de subunidades de nucleótidos.
Polimerasa:
Una enzima o ribosoma que hace un polímero fuera de los monómeros. Por ejemplo, el polimerasa ARN hace al ARN salir de simples nucleótidos.
Ribosomas:
Un atalizador biológico hecho desde el ARN.
Autorreplicante:
Una molecula que puede hacer identicas o casi identicas copias de sí misma a partir de pequeñas subunidades. Se conocen al menos cuatro autorreplicantes.

Problemas con los caulculos creacionistas “tan improbables”.

1) Calculan la probabilidad de la formación de una proteína “moderna” o aún peor una bacteria completa con todas sus proteínas “modernas”, por eventos aleatorios. Esto no es la teoría del abiogénesis de ninguna manera.

2) Asumen que la vida requiere un número fijo de proteínas con sequencias fijas para cada proteína.

3) Calculan la probabilidad como intentos secuenciales en vez de intentos simultaneos.

4) Malinterpretan que es lo que se entiende por calculo deprobabilidades.

5) Sobreestiman seriamente el número de enzimas/ribozomas presentes en un grupo de sequencias aleatorias.

Trataré y les llevaré a través de estos errores, y les mostraré por qué no es posible hacer un calculo de “probabilidad de abiogénesis” de ninguna manera.

Un globulo protoplásmico primordial.

Asi que el calculo es acerca de la probabilidad de la formación de 300 proteínas de aminoácidos largos (esto es, enzimas como la carbonoxipeptidasa) dados aleatoriamente es (1/20)300 o 1 posibilidad en 2.04 x 10390, que es asombrosa y extremadamente improbable. Esto adicionado a la probabilidad de generar 400 o más enzimas similares hasta que se alcanza una figura tan grande que el solo hecho de contemplarla causa que tu cerebro comience a salirse por las orejas. Esto dá la impresión de que la formación del más pequeño organismo parezca totalmente imposible. Sin embargo, esto es completamente incorrecto.

Primeramente, la formación de polímeros biológicos desde monómeros es una función de las leyes de la química y la bioquímica, y estas definitivamente no son aleatorias.

En segundas, toda la premisa es incorrecta desde el principio, porque en las modernas teorías del abiogénesis la primera “cosa viviente” sería mucho más simple, ni siquiera una protobacteria o una preprotobacteria (lo que Oparin llamaba un protobionte, y Woese llama un protogenote), sino que una o más moleculas simple probablemente no más largas que de 30 o 40 subunidades. Estas simples moleculas luego evolucionaron en sistemas cooperativos autoreplicantes, y finalmente en organismos simples. La siguiente ilustración es una camparación entre un protobionte hipotetico y una bacteria moderna.

[Ur Cell figure]

La primera “cosa viviente” podría haber sido una simple molecula autoreplicante, similar a los péptidos “autorreplicantes” del grupo de Ghadiri, o los hexanucleótidos autorreplicantes, o prosiblemente un polímero de ARN que actua sobre sí mismo.

[Self-replicator figure]

Otra visión es que los primeros autorreplicantes fueron grupos de catalizadores, ya sean enzimas protéicas o ribozomas de ARN, estos se regeneraron a sí mismos como un ciclo catalítico. Un ejemplo es la subunidad autorreplicante SunY tres. Estos ciclos catalíticos podrían estar limitados a un charco pequeño o laguna, o ser un complejo catalítico absorbido ya sea por arcilla o material lípido en la arcilla. Dado que hay muchas secuencias catalíticas en un grupo de peptidos o polinucleótidos aleatorios no es improbable que se formara un pequeño complejo catalítico.

Los dos modelos no son mutuamente excluyentes. Los peptidos Ghadiri pueden mutar y formar ciclos catalíticos.

No interesa si los primeros autorreplicantes fueron moleculas simples o complejo de moleculas simples, este modelo no tiene nada que ver con el tornado de Hoyle pasando por un basurero para formar un 747. Solo para establecer el punto, aquí está una comparación simple de la teoría que es criticada por los creacionistas y la actual teoría de la abiogénesis.

[Dos visiones de la abiogénesis]

Notar que la teoría real tiene un número de pequeños pasos intermédios, y, de hecho, he dejado algunos afuera (especialmente entre los estados de hiperciclos y protobiontes) para simplificar. Cada paso está asociado a un pequeño incremento en la organización y la complejidad, y los elementos químicos ascienden hacia lo organico en vez de dar un gran salto.

De dónde los creacionistas sacaron que los modernos organismos aparecieron espontaneamente es incierto. La primera formulación moderna del abiogénesis, la hipótesis Oparin / Haldane de los años ’20, comienza con proteínas / proteinoides simples desarrollandose lentamente en celulas. Incluso las ideas que circulaban de 1850 no fueron teorías de “espontaneidad”. ¡Lo más lejano que pude ir es a las ideas originales de Lamarck de 1803!.

Dado que los creacionistas han estado criticando una teoría de hace 150 años que ningún biólogo moderno sostiene, para ¿qué ir más lejos? Porque hay problemas fundamentales en las estadísticas y la bioquímica que aparecen en estas “refutaciones” erradas.

El mito de la “secuencia de la vida”.

A veces se escucha otra pretención, que hay una “secuencia de la vida” de 400 proteínas, y que las secuencias de aminoácidos de esas proteínas no pueden ser cambiadas, para que los organismos estén vivos.

Esto, sin embargo, son disparates. La pretención de las 400 proteínas parece venir del genoma codificado de proteínas delMycobacterium genetalium, el cual tiene el genoma más pequeño actualmente conocido para un organismo moderno. Sin embargo las inspecciones del genoma sugieren que podrían estar reducidas aún más hasta un conjunto mínimo de genes de 256 proteínas. Notar otra vez que esto es un organismo moderno. El primer protobionte / progenote prodría haber sido aún más pequeño, y estar precedido por aún mas simples sistemas químicos.

Para la pretención de que la secuencia de proteínas no puede ser cambiada, otra vez, esto es un disparate. Hay en la mayoría de las regiones de las proteínas donde casi cualquier aminoácido puede ser substituido, y otras regiones donde las substituciones conservadoras pueden ser hechas (donde los aminoácidos cambiados pueden serlo con otros aminoácidos, neutrales por otros aminoácidos neutrales, aminoácidos hidrofóbicos por otros aminoácidos hidrofóbicos). Algunas moleculas funcionalmente equivalentes pueden tener diferencias entre 30 y 50 % en sus aminoácidos. De hecho es posible sustituir proteínas bacterianas no identicas estructuralmente por proteínas de levadura y proteínas de gusanos por proteínas humanas y el organismo felizmente seguiría vivo.

La “secuencia de la vida” es un mito.

Lanzamiento de monedas para principiantes y ensamble macromolecular.

Asi que juguemos al juego creacionista y miremos la formación de péptidos por suma aleatoria de aminoácidos. Ciertamente esta no es la forma en que los péptidos se formaron en la Tierra temprana pero será instructivo.

Usaré como ejemplo el péptido “autorreplicante” del grupo Ghadiri mencionado más arriba. Podría usar otros ejemplos, tal como el autorreplicante hexanucleótido, el autorreplicante SunY o el polimerasa ARN descripto por el grupo Eckland, pero para continuar con la historia de las pretenciones creacionistas un péptido pequeño es lo ideal. Este péptido tiene un largo de 32 aminoácidos con la secuencia de RMKQLEEKVYELLSKVACLEYEVARLKKVGE y es una enzima, un ligasa péptido que hace una copia de sí mismo de dos subunidades de 16 aminoácidos de longitud. Es además del tamaño y composición que es ideal para ser formado por sintesis abiótica de péptidos. El hecho de que es un autorreplicante es una ironía agregada.

La probabilidad de generar esto en sucesivos intentos aleatorios es (1/20)32 o 1 en 4.29 x 1040. Esto es mucho, mucho mas probable que 1 en 2.04 x 10390 del escenario creacionista estandar de “generar carboxypeptidasa por azar”, pero aún es absurdamente bajo.

Sin embargo, hay otro lado en estas estimaciones probabilísticas, y depende del hecho de que la mayoría de nosotros no tenemos noción de las estadísticas. Cuando alguien nos dice que algún evento tiene una chance en un millón de ocurrir, muchos de nosotros esperamos que se hagan un millon de intentos antes de decir que el evento apareció. Pero esto es incorrecto.

Aquí tienes un experimento que puedes hacer tú mismo: toma una moneda arrojala cuatro veces, escribe los resultados y hazlo de nuevo. ¿Cuántas veces piensas que tendrás que repetir este procedimiento (intento) antes de obtener 4 caras en una sola tanda?

La probabilidad de tener 4 caras en una tanda es ahora de (1/2)4 o 1 chance en 16: ¿tenemos que hacer 16 intentos para obtener 4 caras (CCCC)? no, en experimentos sucesivos obtuve 11, 10, 6, 16, 1, 5, y 3 intentos antes de que CCCC apareciera. La figura 1 en 16 (o 1 en un millón o 1 en 1040) da la probabilidad de un evento en un intento dado, pero no dice cuándo ocurrirá en una serie. Puedes obtener CCCC justo en el primer intento (yo lo conseguí). Aún en una chance en 4.29 x 1040, un autorreplicante podría aparecer sorprendentemente temprano. Pero aún hay más.

Una chance en 4.29 x 1040 aún es asquerosamente inverosimil. Es difícil manejar este número. Aún con el argumento de arriba (podrías obtenerlo en el primer intento) la mayoría de la gente diría “seguramente tomaría mas tiempo que el que la Tierra ha existido hasta obtener este replicador por métodos al azar”. No, realmente. En el ejemplo de arriba estabamos examinando intentos secuenciales (uno detrás del otro), como si hubiera una sola proteína / ADN / proto-replicador siendo ensamblado en cada intento. La verdad es que habría millones de millones de intentos simultaneos como los millones de millones de moléculas en bloque trabajaron recíprocamente en los océanos, o en los miles de kilómetros de costas que pudieron proveer superficies catalíticas o moldes.

Volvamos a nuestro ejemplo con las monedas. Digamos que se toma un minuto en lanzar la moneda 4 veces; para generar CCCC tomará en promedio 8 minutos. Ahora consigue 16 amigos, cada uno con una moneda, para que todos lancen las suyas 4 veces simultaneamente; el promedio de tiempo para generar CCCC es ahora un minuto. Ahora traten de conseguir 6 caras en una tanda, esto tiene la probabilidad de (1/2)6 o 1 en 64. Esto tomaría una media hora en promedio, pero salgan y consigan 64 personas, y ahora vuelven a tener 1 minuto de tiempo promedio. Si quieres obtener una secuencia con una chance de 1 en mil millones, solamente recluta a la población de China para que lancen monedas para tí y tendrás esa secuencia en practicamente nada de tiempo.

Asi que si en nuestra Tierra prebiótica tenemos mil millones de peptidos creciendo simultaneamente, eso reduce el tiempo para generar nuestro replicador muy significativamente.

Ok, estas mirando ese número otra vez, una chance en 4.29 x 1040, ese es un número MUY grande, y si bién mil millones de moleculas primordiales son muchas moleculas, ¿podríamos obtener alguna vez suficientes moleculas para ensamblar aleatoriamente nuesto primer replicador en menos de la mitad de mil millones de años?

Sí, por supuesto, un kilogramo de aminoácido tiene 2.85 x 1024 moleculas en él (esto es más de un billón); una tonelada tiene 2.85 x 1027 moleculas. Si tomaramos un semiremolque cargado de cada uno de los aminoácidos y los tiramos en el medio de un lago tendrías suficientes moleculas como para generar nuestro replicador en particular en menos de 10 años, dado que puedes hacer 55 proteínas de aminoácidos largos en una o dos semanas.

Entonces, ¿cómo encaja esto en la Tierra prebiótica? En la Tierra temprana es probable que los oceanos hallan tenido un volumen de 1 x 1024 litros. Dada una concentración de aminoácidos de 1 x 10-6 M (una sopa moderadamente diluida, ver Chyba y Sagan 1992) hay aproximadamente 1 x 1050 potenciales cadenas primigenias, asi que un número razonable de ligasa péptidos eficientes (alrededor de 1 x 1031) se podrían producir en casi un año, dejenlos solos un millón de años… La sintesis de autorreplicantes primitivos podría suceder relativamente rápido, aún dada la probabilidad de 1 chance en 4.29 x 1040 (y recuerda, nuestro replicador podría ser sintetizado justo en el primer intento).

Asume que toma una semana en generar una secuencia. Entonces el ligasa Ghadiri podría generarse en una semana, y cualquier secuencia citocroma C podría generarse en apenas un millón de años (junto con alrededor de la mitad de todas las secuencias de peptidos posibles, una gran proporción de las cuales serán proteínas funcionales de algún tipo).

Si bién he usado la ligasa Ghadini como un ejemplo, como mencioné más arriba los mismos calculos pueden ser hechos para los autorreplicantes SunY, los polimerasas de ARN de Eckland. Dejo esto como ejercicios para el lector, pero en general la conclusión es la misma para estos oligonucleótidos.

Espacios de busqueda, o ¿cuántas agujas hay en un pajar?

Así, he mostrado que generar una pequeña enzima cualquiera no es extremadamente difícil como los creacionistas (y Fred Hoyle) sugieren. Otra malainterpretación es que la mayoría de la gente cree que el número de enzimas / ribosomas, dejando de lado los polimerasas de ARN o cualquier forma de autorreplicantes, representa una configuración muy inverosimil y que las chances para que una simple formación de enzimas / ribosomas, dejando de lado el número de ellos, desde una suma aleatoria de acidos / nucleótidos es muy pequeña.

Sin embargo, un análisis hecho por Eckland sugiere que en el espacio de secuencia de 220 nucleótidos de ARN largos, 2.5 x 10112 secuencias son ligasas eficientes. No está mal para un compuesto previamente pensado para ser solo estructural. Volviendo a nuestro oceano primitivo de 1 x 1024 litros y asumiendo una concentración de nucleótidos de 1 x 10-7 M, entonces hay mas o menos 1 x 1049 cadenas de potenciales nucleótidos, asi que un número razonable de ligasas de ARN eficientes (alrededor de 1 x 1034) podrían ser producidas en un año, dejenlas solas un millón de años… El potencial número de polimerasas de ARN es además, alto, alrededor de 1 en cada 1025 secuencias es una polimerasa de ARN. Consideraciones similares se aplican para las transferasa acrilribosomicas (alrededor de 1 por cada 1015 secuencias), y para las sintesis de nucleótidos ribosomicas.

Asi que, aún con más números realísticos, el ensamblaje aleatorio de aminoácidos en sistemas con “soporte de vida”, parecería ser bastante factible, aún con los números más pesimistas para la concentración de monómeros original y el tiempo de sintesis.

Conclusiones.

La gran premisa de los calculos de probabilidad de los creacionistas es incorrecta en primer lugar porque se basa en la teoría incorrecta. Más aún, este argumento a veces está contaminado con falacias estadísticas y biológicas.

En este momento, desde que no tenemos idea de cuán probable es la vida, es virtualmente imposible asignar probabilidades significativas a ninguno de los pasos de la vida excepto a los primeros dos (monomeros a polímeros p=1.0, formación de polímeros catalíticos p=1.0). Para los polímeros replicantes a la transición de hiperciclo la probabilidad bién puede ser 1.0 siKauffman tiene razón acerca del “cierre catalítico” en sus modelos de transición de fase, pero esto requiere química real y modelación más detallada para confirmarlo. Para la transición hiperciclo -> protobionte, la probabilidad es dependiente de conceptos teóricos que aún están siendo desarrollados y es desconocido.

Sin embargo, al final, la factibilidad de la vida depende de la química y la bioquímica que siguen siendo estudiadas, y no lanzando monedas al aire precisamente.

Referencias (en inglés).

[1] Unrau PJ, and Bartel DP, RNA-catalysed nucleotide synthesis. Nature, 395: 260-3, 1998

[2] Orgel LE, Polymerization on the rocks: theoretical introduction. Orig Life Evol Biosph, 28: 227-34, 1998

[3] Otsuka J and Nozawa Y. Self-reproducing system can behave as Maxwell’s demon: theoretical illustration under prebiotic conditions. J Theor Biol, 194, 205-221, 1998

[4] Woese C, The universal ancestor. Proc Natl Acad Sci USA, 95: 6854-6859.

[5] Varetto L, Studying artificial life with a molecular automaton. J Theor Biol, 193: 257-85, 1998

[6] Wiegand TW, Janssen RC, and Eaton BE, Selection of RNA amide synthases. Chem Biol, 4: 675-83, 1997

[7] Severin K, Lee DH, Kennan AJ, and Ghadiri MR, A synthetic peptide ligase. Nature, 389: 706-9, 1997

[8] Ruse M, The origin of life, philosophical perspectives. J Theor Biol, 187: 473-482, 1997

[9] Lee DH, Severin K, Yokobayashi Y, and Ghadiri MR, Emergence of symbiosis in peptide self-replication through a hypercyclic network. Nature, 390: 591-4, 1997

[10] Lee DH, Severin K, and Ghadri MR. Autocatalytic networks: the transition from molecular self-replication to molecular ecosystems. Curr Opinion Chem Biol, 1, 491-496, 1997

[11] Di Giulio M, On the RNA world: evidence in favor of an early ribonucleopeptide world. J Mol Evol, 45: 571-8, 1997

[12] Ekland EH, and Bartel DP, RNA-catalysed RNA polymerization using nucleoside triphosphates. Nature, 383: 192, 1996

[13] Lohse PA, and Szostak JW, Ribozyme-catalysed amino-acid transfer reactions. Nature, 381: 442-4, 1996

[14] Ferris JP, Hill AR Jr, Liu R, and Orgel LE, Synthesis of long prebiotic oligomers on mineral surfaces [see comments]. Nature, 381: 59-61, 1996

[15] Lazcano A, and Miller SL, The origin and early evolution of life: prebiotic chemistry, the pre- RNA world, and time. Cell, 85: 793-8, 1996

[16] Ertem G, and Ferris JP, Synthesis of RNA oligomers on heterogeneous templates. Nature, 379: 238-40, 1996

[17] Lee DH, Granja JR, Martinez JA, Severin K, and Ghadri MR, A self-replicating peptide. Nature, 382: 525-8, 1996

[18] Joyce GF, Building the RNA world. Ribozymes. Curr Biol, 6: 965-7, 1996

[19] Ishizaka M, Ohshima Y, and Tani T, Isolation of active ribozymes from an RNA pool of random sequences using an anchored substrate RNA. Biochem Biophys Res Commun, 214: 403-9, 1995

[20] Mushegian AR and Koonin, EV, A minimal gene set for cellular life derived by comparison of complete bacterial genomes.Proc. Natl. Acad. Sci. USA, 93: 10268-10273.

[21] Ekland EH, Szostak JW, and Bartel DP, Structurally complex and highly active RNA ligases derived from random RNA sequences. Science, 269: 364-70, 1995

[22] Breaker RR, and Joyce GF, Emergence of a replicating species from an in vitro RNA evolution reaction.Proc Natl Acad Sci U S A, 91: 6093-7, 1994

[23] Chyba C and Sagan C, Endogenous production, exogenous delivery and impact-shock synthesis of organic molecules: an inventory for the origins of life. Nature, 355: 125-32., 1992

[24] Doudna JA, Couture S, and Szostak JW, A multisubunit ribozyme that is a catalyst of and template for complementary strand RNA synthesis. Science, 251: 1605-8, 1991

[25] Lahav N, Prebiotic co-evolution of self-replication and translation or RNA world? J Theor Biol, 151: 531-9, 1991

[26] Stadler PF, Dynamics of autocatalytic reaction networks. IV: Inhomogeneous replicator networks. Biosystems, 26: 1-19, 1991

[27] Eigen M, Gardiner W, Schuster P, and Winkler-Oswatitsch R, The origin of genetic information. Sci Am, 244: 88-92, 96, et passim, 1981

[28] Eigen M, and Schuster P, The hypercycle. A principle of natural self-organization. Springer-Verlag, isbn 3-540-09293, 1979

[29] Yockey HP, On the information content of cytochrome c. J Theor Biol, 67: 345-76, 1977

Libros utiles (en inglés).

Statistics at Square One, T.D.V. Swinscow, 8th Edition Paperback, Published by Amer College of Physicians, 1983, ISBN: 0727901753

Evolution from Space, F Hoyle and Wickramasinghe, JM Dent and sons, London, 1981

Vital Dust: Life As a Cosmic Imperative, by Christian De Duve, Basic Books 1995, ISBN: 0465090451

The Major Transitions in Evolution, Maynard Smith J & Szathmary E, 1995, WH Freeman, ISBN: 0716745259

The Origins of Order: Self Organization and Selection in Evolution. By Stuart Kauffman, S. A. (1993) Oxford University Press, NY, ISBN: 0195079515.

At Home in the Universe. By Stuart Kauffman, 1995) Oxford University Press, NY.

Links (en inglés).

Agradecimientos.

Gracias a John Wilkins y Jthomford por la valiosa ayuda, sugerencias y discusiones. Gracias a John por los buenos GIFs y JPEGS.

Fuente:Mentiras, malditas mentiras, Estadísticas y la Probabilidad de los cálculos de la Abiogénesis,por Ian Musgrave,Copyright © Diciembre 1998,Adaptado y traducido por Diego Romero (Driver_Op),El documento original puede ser encontrado aquí,http://www.driverop.com.ar/abioprob.php)

Lo mucho que debemos a los cometas

Lo mucho que debemos a los cometas

(NC&T) Mientras investigaba la composición química de cometas, el Profesor Akiva Bar-Nun, del Departamento de Geofísica y Ciencias Planetarias en la Universidad de Tel Aviv, encontró nuevos indicios de que ellos fueron la fuente de los ingredientes necesarios que faltaban para hacer posible la vida en la antigua “sopa” bioquímica primordial de la Tierra.

Fue la composición química de los cometas, opina el Profesor Bar-Nun, la que les permitió ejercer de iniciadores de la vida.

Usando una máquina única en su tipo, construida en la Universidad de Tel Aviv, los investigadores pudieron simular el hielo de un cometa, y encontraron que éstos contienen los ingredientes necesarios para proporcionar los nutrientes básicos de la vida.

Material de los cometas
Un cometa en el cielo de la Tierra. (Foto: TAU)

Específicamente, el profesor Bar-Nun observó los gases nobles Argón, Kriptón y Xenón, porque ellos no interactúan con ningún otro elemento y no se destruyen por el oxígeno de la Tierra. Estos elementos han mantenido proporciones estables en la atmósfera terrestre a lo largo de la historia del planeta.

Los cometas son esencialmente grandes bloques de hielo cuya temperatura varía de -200 a -250 grados centígrados, excepto en los casos de aquellos que se acercan mucho al Sol. Formados en los primeros tiempos del sistema solar y muy alejados del Sol, su hielo es el resultado de vapor de agua que pasó directamente al estado sólido, formando pequeños granos. Estos granos se unieron para formar los cometas.

Durante la formación de los cometas, el hielo poroso atrapaba gases y sustancias químicas orgánicas que estaban presentes en el espacio exterior. El patrón de captura de los gases nobles en el hielo muestra una cierta proporción entre el Argón, el Kriptón y el Xenón, y esta proporción, junto a la proporción también específica de gases que provienen de cuerpos rocosos, nos da la que observamos en la atmósfera de la Tierra.

Así, la llegada a la Tierra de cometas y asteroides condujo a la proporción necesaria de materiales para la vida orgánica, que se disolvieron en el océano e iniciaron el largo proceso que llevó a la aparición de vida en la Tierra.

Nota:

Sin duda, esta es la teoria de la abiogénesis que vez tras vez quiere cobrar neuvas fuerzas.Pero obviamente esto no resuelve finalmente el problema del origen de la vida. Solo lo traslada a otro lugar. Yo personalmente sigo ceyendo que:

  • ” Al principio Dios creó el cielo y la tierra.” Gen. 1:1

Aunque me tilden de fanático y de bruto, mi fe y mi confianza están puestas en el Señor, Dios Todo  Poderoso, creador del cielo y de la Tierra. Y en su Palabra.

Y como decía el Salmista David

  • “¿Por qué te abates, oh alma mía, Y por qué te turbas dentro de mí? Espera en Dios; porque aún he de alabarle, Salvación mía y Dios mío.” Sal. 43:5:

Y al igual que el salmista David, recapacito luego de todo  cuestionamiento que me puedo hacer inevitablemente, ya que me es imposible no pensar,pero pienso en la grandeza de Dios y me respondo a mi mismo:

  • “Espera en Dios; porque aún he de alabarle, Salvación mía y Dios mío”.

Por un momento el salmista se da cuenta de que no hay porque estar abatido, que no hay por que estar turbado, puesto que el esperar en Dios le dará salvación. Igual nsootros,ante la grandeza de la creacion dvina,no podemos menos que decir

2. ¡Señor, Dios nuestro,
qué admirable es tu nombre
en toda la tierra!

Ensalzaste tu majestad sobre los cielos.
3. De la boca de los niños de pecho
has sacado una alabanza contra tus enemigos,
para reprimir al adversario y al rebelde.

4. Cuando contemplo el cielo,
obra de tus dedos,
la luna y las estrellas que has creado,
5. qué es el hombre para que te acuerdes de él;
el ser humano, para darle poder.

6. Lo hiciste poco inferior a los ángeles,
lo coronaste de gloria y dignidad,
7. le diste el mando sobre las obras de tus manos,
todo lo sometiste bajo sus pies.

8. Rebaños de ovejas y toros,
y hasta las bestias del campo,
9. las aves del cielo, los peces del mar,
que trazan sendas por el mar.

10. ¡Señor, Dios nuestro,
qué admirable es tu nombre
en toda la tierra! (Salmo 8)

    Dios te bendiga

    Fuente: http://www.solociencia.com

    Fe católica atrae a numerosos miembros de tribus en la zona noreste de India

    Fe católica atrae a numerosos miembros de tribus en la zona noreste de India

    KÖNIGSTEIN, 20 May. 09 (ACI).- En declaraciones a la organización internacional Ayuda a la Iglesia Necesitada (AIN) el P. Thomas Manjaly de la Diócesis de Shiolong en la región noreste de India, explicó que la fe católica resulta cada vez más atractiva para los miembros de las distintas tribus presentes en esa zona, en donde la cristiandad ha experimentado un notable crecimiento.

    El sacerdote relató que una de las creencias fundamentales de estas tribus “incluye un dios que ha creado todo, por lo que encuentran al Cristianismo más cercano a sus creencias que el hinduismo. No creen en la reencarnación como ellos, sino que cuando una persona muere, va hacia Dios”.

    Asimismo, explica, “tienen oraciones por los muertos, que se pasa de persona a persona oralmente. Así que nuestra liturgia por los muertos les resulta muy atractiva”.

    Dado, además, que poseen cierto sistema de sacrificio, pues “luego de las cosechas ofrecen los primeros frutos como sacrificio de agradecimiento; y cuando llegan las primeras lluvias ofrecen semillas para tener una buena siembra, la Eucaristía como sacrificio, el altar y el sacerdote resultan muy atractivos para ellos. La fe católica está así más cerca de ellos y resulta más atractiva que el cristianismo protestante que solo enfatiza el anuncio de la palabra”.

    En tres estados de la zona noreste de India –Nagaland, Meghalaya y Mizoram– los cristianos son mayoría. En Nagaland los cristianos son el 90 por ciento de la población, aunque los presbiterianos y los bautistas son más numerosos que los católicos.

    Al explicar que ahora se inicia la segunda fase de la evangelización, el P. Manjaly aseguró que la traducción que AIN ha realizado de la Biblia a 10 idiomas de la región “es una gran cosa que han hecho por la formación en la fe” así como los proyectos que sostienen económicamente para instruir a los catequistas.

    “Quiero agradecer a AIN por su papel en la construcción de la Iglesia en India. Que Dios los bendiga. Los acompañamos como hermanos y rezamos por ustedes”, concluyó.

    Zeitgeist, el Fraude (5)

    Zeitgeist, el Fraude (5)

    Jesucristo:

    ¿Una imitación de Dionisio, Horus, Krishna, Mitras y Attis?

    AttisEste es el último dios pagano que Zeitgeist hace desfilar ante nuestros ojos para probar que Jesucristo es uno de los tantos “mesías solares” imaginarios creados por el sistema de creencia astrológica de las culturas de la antigüedad. El relator de la película repite el clásico mantra:

    Attis de Frigia, nacido de la virgen Nana Diciembre 25, crucificado, puesto en una tumba y luego de 3 días resucitado”.

    Esta es la “biografía” de Attis tal como la presenta Zeitgeist. Veamos ahora cuánto hay de cierto en ella. Para ello recurriremos a un geógrafo del 2do. siglo después de Cristo, de nombre Pausanias, quien registró varias tradiciones de Attis. Si usted es delicado respecto a las imágenes porno-sangrientas concebidas por la religiosidad pagana, le aconsejo no leer la siguiente cita.

    “Zeus, se dice, dejó caer en su sueño su simiente en la tierra, la cual a su tiempo envió arriba un demonio con órganos sexuales, masculino y feminino. Al demonio le llamaron Agditis. Los dioses, temiendo a Agditis, le cortaron el órgano masculino, y de éste creció un almendro con su fruta Madura, y una hija del río Sangarius, ellos dicen, tomo de la fruta y la colocó en sus senos desde donde desapareció de inmediato pero quedó en cinta. Un niño le nació, le abandonó y fue criado por un chivo macho. A medida que crecía su hermosura era más que humana, y Agditis se enamoró de él. Una vez adulto, Attis fue enviado por sus familiares a Pessinus para que se casara con la hija del rey. Mientras se cantaba la balada del matrimonio apareció Agditis y Attis enloqueciendo se cortó sus genitales … pero Agditis se arrepintió de lo que hizo y persuadió a Zeus para que le entregara el cuerpo de Attis, de ese modo no se pudriría”. (Description of Greece 7.17.10-12) [1]

    ¡Bonita historia! Mezcla de eyaculaciones nocturnas con hermafroditismo, reminiscencias de la ecuatoriana Lorena Bobbit, quien, algunos recordarán, cortó a navaja el asta procreacional de su marido, senos consumidores de fruta, chivas macho con tendencias maternas, un Attis con parientes cuadrúpedos y una escena de automutilación en medio de una ceremonia nupcial; hermoso cuento infantil. Antes de esta tradición, Pausanias había documentado otra en la cual Attis muere víctima de un jabalí:

    “ El poeta elegíaco Hermesianax dice en un poema que [Attis] fue el hijo de Galaus el Frigio, y que fue un eunuco de nacimiento. La narración de Hermesianax sigue diciendo que aun no crecido, Attis emigró a Lidia y celebraba para los Lidios las orgias de la Madre; que alcanzó tal honor que Zeus, furioso contra él, envió un puerco salvaje a destruir los plantíos de los Lidios. Entonces ciertos Lidios y Attis mismo fueron muertos por el cerdo, y esto explica el hecho de que los Galos que habitan en Pessinus se abstengan de comer puerco”, (Description of Greece 7.17.9-10) [2]

    Otras historias dicen que:

    1) Attis fue muerto por Adrasto, el hombre encargado de protegerlo, cuando éste arrojó una lanza destinada a matar un puerco salvaje gigante con tan mala puntería que atravesó a Attis accidentalmente. [3]

    2) Attis era el amante de Cibeles, a quien le prometió amor eterno, pero cuando Attis la engaña con la ninfa Sagaritis, Cibeles en venganza hiere un árbol que era muy especial para Attis, lo cual hace a éste perder la razón y castrarse [4]. Finalmente, cuenta la historia, Attis muere debajo de un pino.[5]

    3) Cibeles causa la muerte de Attis luego de abortar un hijo de él. Cibeles no permitió que su cuerpo sea enterrado y tiempo más tarde se ordena a los Frigios sepultar el cuerpo. Al no poderlo encontrar se procedió a celebrar el funeral usando una estatua de Attis. [6]

    Luego de tantas historias, ya sabemos exactamente cómo murió Attis, ¿verdad? Ahora veamos si es cierto que resucitó. Prepárese el lector para otra dosis de material repulsivo e incestuoso, herencia cultural de los griegos. Es difícil entender como toda esta basura influenció luego a una larga lista de artistas, escritores, filósofos, compositores y productores de películas, y es enseñada en nuestras universidades.

    Es en el tercer siglo D.C. donde encontramos más detalles de la tradición de Attis. Zeus trató de impregnar a su propia madre pero sin éxito y su semen cayó en una roca llamada Agdus. La roca quedó preñada y dio a luz un ser andrógeno, Agditis. Parece que Agditis era bastante mal portado por lo cual los dioses deciden drogarlo con vino y durante su sopor le atan una cuerda a sus genitales. Cuando se despierta se levanta furioso y al salir corriendo pierde “las joyas de la familia”. De la sangre que brota nace un granado. Nana, la hija de Sangarius, come de la fruta del árbol y queda embarazada de Attis. La Madre Diosa (madre de Zeus) y Agditis amaron a Attis intensamente (no con un amor materno ni filial precisamente). La historia continúa con otros detalles hasta que finalmente Attis se castra debajo de un pino. Las “muchachas” le piden a Zeus que lo reviva, pero Zeus se niega y sólo asiente a que el cuerpo de Attis nunca se deteriore, que sus cabellos siempre crezcan y que su dedo meñique esté siempre en constante movimiento (me niego a especular en este último atributo concedido al cuerpo de Attis).

    ¿Fue crucificado Attis? Eso es lo que Zeitgeist reclama basándose en que en algunas de las historias fue enterrado debajo de un pino. No vemos el paralelo. Resumiendo: No hay ninguna indicación en las historias de que la madre de Attis haya sido una virgen, que Attis haya nacido un 25 de diciembre, o haya sido crucificado y luego resucitado. Todo se trata de otra mentira para confundir y engañar a un vasto público de débiles mentales. <>

    Notas:

    1] http://www.perseus.tufts.edu/cgi-bin/ptext?lookup=Paus.+7.17.10 — Cit. http://jb-fidei-defensor.xanga.com/638110989/zeitgeist-rebuttal-speech/

    2] http://www.perseus.tufts.edu/cgi-bin/ptext?lookup=Paus.+7.17.9 – Cit.http://jb-fideidefensor.xanga.com/638110989/zeitgeist-rebuttal-speech/

    3] http://www.perseus.tufts.edu/cgi-bin/ptext?lookup=Hdt.+1.34.1 — Cit.http://jb-fideidefensor.xanga.com/638110989/zeitgeist-rebuttal-speech/

    4] (Fasti 4.221ff),http://www.tkline.freeserve.co.uk/OvidFastiBkFour.htm#_Toc69367847 — Cit.http://jb-fideidefensor.xanga.com/638110989/zeitgeist-rebuttal-speech/

    5] http://www.perseus.tufts.edu/cgi-bin/ptext?lookup=Ov.+Met.+10.103 — Cit. http://jb-fideidefensor.xanga.com/638110989/zeitgeist-rebuttal-speech/

    6] (Adversus Gentes 5.5-7) http://www.sacred-texts.com/chr/ecf/006/0060138.htm — Cit. http://jb-fideidefensor.xanga.com/638110989/zeitgeist-rebuttal-speech/

    Hoy es el Día de la Metrología

    Hoy es el Día de la Metrología

    Posted: 20 May 2009 10:19 AM PDT

    Un lector de Genciencia, Hugo Torres, ha tenido la gentileza de avisarme de que hoy es un día de celebración.

    Felicidades, hoy se celebra el Día Internacional de la Metrología, que no tenía nada que ver con el metro (entendido como transporte suburbano) ni con la meteorología (para aquéllos que escriban un poco mal la palabra).

    El 20 de mayo de 1875, en Sèvres, Francia, 17 naciones firmaron un tratado aún vigente conocido como La convención del metro bajo el auspicio del Comité Internacional de Pesos y Medidas.

    Las primeras mediciones se basaban en cosas tan variables como las partes del cuerpo humano. Por ejemplo, una cuerda se medía con los brazos extendidos desde la punta de los dedos de una mano a la otra: una braza. Los problemas comerciales que esto generaba eran notables, incluso en una misma ciudad.

    No fue hasta la Revolución Francesa que se optó por un modelo unificador y duradero que traspasara las fronteras. En la primera reunión, celebrada en 1889, se definió el kilogramo patrón, y se adoptaron el metro patrón internacional y el quilate, equivalente a 200 miligramos.

    Este tratado, también, dio pie a tres instituciones:

    -La CONFERENCIA GENERAL DE PESOS Y MEDIDAS: la mayor autoridad internacional en cuanto a la homologación de unidades y mediciones.

    -El COMITÉ INTERNACIONAL DE PESOS Y MEDIDAS: la mayor autoridad técnica a nivel internacional. Está conformado por los mejores científicos metrólogos del mundo. Se encarga de seguir el acontecer científico mundial para mejorar las definiciones de las unidades y los patrones primarios.

    -La OFICINA INTERNACIONAL DE PESOS Y MEDIDAS: lugar donde se custodian de los mejores patrones del mundo.

    Actualmente los países firmantes son 51. Así que felicidades a todos ellos por participar de un lenguaje de medidas que todos entendemos.

    Vía | Quarks de todos los sabores
    Sitio Oficial | World Metrology Day

    Fuente: Genciencia

    EL PACTO DE LAUSANA

    EL PACTO DE LAUSANA

    INTRODUCCIÓN

    Como miembros de la Iglesia de Jesucristo, provenientes de más de 150 naciones, que hemos participado en el Congreso Internacional sobre Evangelización Mundial en Lausana, alabamos a Dios por Su gran salvación y nos regocijamos en la comunión que nos ha dado consigo mismo y del uno para con el otro. Impulsados al arrepentimiento por nuestros fracasos, y desafiados por la inconclusa tarea de la evangelización, nos sentimos profundamente conmovidos por las cosas que Dios está haciendo en nuestros días. Creemos que el Evangelio es la buena nueva de Dios para todo el mundo, y por Su gracia, estamos decididos a obedecer la comisión de Cristo, de proclamarla a toda la humanidad, y hacer discípulos de todas las naciones. Deseamos, por lo tanto, afirmar nuestra fe y nuestra resolución y hacer público nuestro pacto.

    1. EL PROPÓSITO DE DIOS
    Afirmamos nuestra fe en un solo Dios eterno, como Creador y Señor del mundo, Padre, Hijo, y Espíritu Santo, que gobierna todas las cosas según el propósito de Su voluntad. El ha estado llamando, del mundo, un pueblo un pueblo par Sí, y enviándolo al mundo como siervos y testigos Suyos, para la extensión de Su Reino, la edificación el cuerpo de Cristo y la gloria de Su Nombre. Confesamos con vergüenza que a menudo hemos negado nuestro llamamiento y fallado en nuestra misión, conformándonos al mundo o separándonos de él. Sin embrago, nos regocijamos de que, aunque en vasos de barro, el Evangelio sigue siendo un precioso tesoro. A la tarea de dar a conocer ese tesoro, por el poder del Espíritu Santo, deseamos dedicarnos de nuevo. Isa. 40:28; Mat. 28:19; Ef. 1:11; Hech. 15:15; Juan 17:6,18; Ef. 4:12; 1 Cor. 5:10; Rom. 12:2; 2 Cor. 4:7

    2. AUTORIDAD Y PODER DE LA BIBLIA
    Afirmamos la divina inspiración, fidelidad y autoridad de las Sagradas Escrituras del Antiguo y del Nuevo Testamento, sin error en todo lo que aseveran, y que son la única norma infalible de fe y conducta. Afirmamos también el poder de la Palabra de Dios para cumplir Su propósito de salvación. El mensaje de la Biblia se dirige a toda la humanidad, puesto que la revelación de Dios en Cristo y en las Escrituras es inalterable. Por medio de ella el Espíritu Santo sigue hablando hoy. El ilumina la mente del pueblo de Dios en cada cultura, para percibir la verdad nuevamente con sus propios ojos, y así muestra a toda la iglesia más de la mulltiforme sabiduría de Dios. 2 Tim. 3:16; 2 Pedro 1:21; Juan 10:35; Isa. 55:11; 1 Cor. 1:21; Rom. 1:16; Mat. 5:17,18; Judas 3, Ef. 1:17,18; 3:10,18.

    3. SINGULARIDAD Y UNIVERSALIDAD DE CRISTO
    Afirmamos que hay un solo Salvador y un solo Evangelio aunque existen diversos acercamientos a la evangelización. Reconocemos que todos los hombres tienen algún conocimiento de Dios por medio de Su revelación general en la naturaleza. Pero rechazamos también, como un insulto a Cristo y al Evangelio, toda clase de sincretismo y diálogo que implique que Cristo habla igualmente por medio de todas las religiones e ideologías. Jesucristo es el Dios-hombre que se entregó a Sí mismo como único mediador entre Dios y el hombre. No hay otro nombre en que podamos ser salvos. Todos los hombres perecen causa del pecado, pero Dios ama a todos los hombres y es Su deseo que ninguno perezca sino que todos se arrepientan. Sin embargo, los que rechazan a Cristo repudian el gozo de la salvación y se condenan a una eterna separación de Dios. Proclamar a Jesús como “El Salvador del mundo” no es afirmar que todos los hombres son salvos automática o finalmente, y menos aún afirmar que todas las religiones ofrecen la salvación en Cristo. Es mas bien, proclamar al mundo de los pecadores e invitar a todos los hombres a responder al El como Señor y Salvador en la entrega personal y auténtica del arrepentimiento y la fe. Jesucristo ha sido exaltado sobre todo nombre: esperamos el día cuando toda rodilla se doble ante El y toda lengua lo confiese como Señor. Gál. 1:8,9; Rom. 1:18,32; 1 Tim. 2:5,6; Hech. 4:12; Juan 3:16-19; 2 Tes, 1:7-9; Juan 4:42; Mat. 11:28; Ef. 1:20,21; Fil.2:9-11.

    4. NATURALEZA DE LA EVANGELIZACIÓN
    Evangelizar es difundir la buena nueva de que Jesucristo murió por nuestros pecados y resucitó de los muertos según las Escrituras, y que ahora como el Señor que reina ofrece el perdón de los pecados y el don liberador del Espíritu Santo a todos los que se arrepienten y creen. Nuestra presencia cristiana en el mundo es indispensable para la evangelización; también los es un diálogo cuyo propósito sea escuchar con sensibilidad a fin de comprender. Pero la evangelización es la proclamación misma del Cristo histórico y bíblico como Salvador y Señor, con el fin de persuadir a las gentes a venir a El personalmente y reconciliarse con Dios. Al hacer la invitación del Evangelio, no tenemos la libertad para ocultar o rebajar el costo del discipulado. Jesús todavía llama, a todos los que quieran seguirlo, a negarse a sí mismos, tomar su cruz e identificarse con su nueva comunidad. Los resultados de la evangelización incluyen la obediencia a Cristo, la incorporación en Su iglesia y el servicio responsable en el mundo. 1 Cor. 15:3,4; Hech. 2:32-39; Juan 20:21; 1 Cor. 1:23; 2 Cor. 4:5; 5:11-20; Luc. 14:25-33; Mar. 8:34; Hech. 2:40,47; Mar. 10:43-45

    5. RESPONSABILIDAD SOCIAL CRISTIANA
    Afirmamos que Dios es tanto el Creador como el Juez de todos los hombres. Por lo tanto, debemos compartir Su preocupación por la justicia y la reconciliación en toda la sociedad humana, y por la liberación de todos los hombres de toda clase de opresión. La humanidad fue hecha a la imagen de Dios; consecuentemente, toda persona, sea cual sea su raza, religión, color, cultura, clase, sexo, o edad tiene una dignidad intrínseca, en razón de la cual debe ser respetada y servida, no explotada. Expresamos además nuestro arrepentimiento, tanto por nuestra negligencia, como por haber concebido, a veces, la evangelización y la preocupación social como cosas que se excluyen mutuamente. Aunque la reconciliación con el hombre no es lo mismo que la reconciliación con Dios, ni el compromiso social es lo mismo que la evangelización, ni la liberación política es lo mismo que la salvación, no obstante afirmamos que la evangelización y la acción social y política son parte de nuestro deber cristiano. Ambas son expresiones necesarias de nuestra doctrina de Dios y del hombre, de nuestro amor al prójimo y de nuestra obediencia a Jesucristo. El mensaje de la salvación implica también un mensaje de juicio a toda forma de alienación, opresión y discriminación, y no debemos temer el denunciar el mal y la injusticia dondequiera que existan. Cuando la gente recibe a Cristo, nace de nuevo en Su Reino y debe manifestar a la vez que difundir Su justicia en medio de un mundo injusto. La salvación que decimos tener, debe transformarnos en la totalidad de nuestras responsabilidades, personales y sociales. La fe sin obras es muerta. Hech. 17:26,31; Gén. 18:25; Isa. 1:17; Sal. 45:7; Gén. 1:26,27; Sant. 3:9; Lev. 19:18; Luc. 6:27,35; Sant. 2:26-26; uan 3:3,5; Mat. 5:20; 6:33; 2 Cor. 3:18.

    6. LA IGLESIA Y LA EVANGELIZACIÓN
    Afirmamos que Cristo envía a los redimidos al mundo así como el Padre lo envió a El, y que ello exige una similar penetración profunda y costosa en el mundo. Necesitamos salir de nuestros ghettos eclesiásticos y penetrar en la sociedad no cristiana. En la misión de la Iglesia, que es misión de servicio sacrificial, la evangelización ocupa el primer lugar. La evangelización mundial requiere que toda la Iglesia lleve todo el Evangelio a todo el mundo. La Iglesia está en el corazón mismo del propósito cósmico de Dios y es el instrumento que El ha designado para la difusión del Evangelio. Pero una Iglesia que predica l cruz debe ella misma estar marcada por la cruz. Se convierte en una piedra de tropiezo para la evangelización cuando traiciona al Evangelio o carece de una fe viva en Dios, un genuino amor a los hombres, o una escrupulosa honradez en todas las cosas, incluyendo la promoción y las finanzas. La Iglesia es la comunidad del Pueblo de Dios, mas bien que una institución, y no debe identificarse con una cultura, sistema social o político, o ideología humana particular. Juan 17:18, 20-21; Mat. 29:19-20; Hech. 1:8; 20:27; Ef. 1:9; 3:9-11; Gál. 6:14,17; 2 Cor. 6:3,4; 2 Tim. 2:19-21; Fil. 1:27.

    7. COOPERACIÓN EN LA EVANGELIZACIÓN
    Afirmamos que la unidad visible de la Iglesia en la verdad es el propósito de Dios. La evangelización también nos invita a la unidad, puesto que la unidad fortalece nuestro testimonio, así como nuestra falta de unidad menoscaba nuestro evangelio de reconciliación. Reconocemos, sin embargo, que la unidad organizacional puede tomar muchas formas y no necesariamente sirve a la causa de la evangelización. No obstante, los que compartimos la misma fe bíblica, debemos estar estrechamente unidos en comunión, trabajo y testimonio. Confesamos que nuestro testimonio ha estado a veces marcado por un individualismo pecaminoso y una duplicación innecesaria. Nos comprometemos a buscar una unidad más profunda en la verdad, la adoración, la santidad y la misión. Urge el desarrollo de una cooperación regional y funcional para el avance de la misión de la iglesia, el planeamiento estratégico, el ánimo mutuo y el compartir de recursos y experiencia. Juan 17:21,23; Ef. 4:3,4; Juan 13:35; Fil. 1:27; Juan 17:1-23.

    8. LA IGLESIA Y EL COMPAÑERISMO EN LA EVANGELIZACIÓN
    Nos gozamos de que una nueva era misionera haya empezado. El viejo modelo de dominación occidental está desapareciendo rápidamente. Dios está levantando de las iglesias jóvenes, grandes y nuevos recursos para la evangelización mundial, y está demostrando así que la responsabilidad de evangelizar pertenece a todo el cuerpo de Cristo. Todas las iglesias, por lo tanto, deben preguntar a Dios y preguntarse a sí mismas lo que deben hacer para evangelizar su propia área y enviar misioneros a otros países del mundo. Le evaluación de nuestra responsabilidad y la tarea misionera debe ser contínua. Así crecerá el compañerismo entre las iglesias y se manifestará, con mayor claridad, el carácter universal de Cristo. También damos gracias a Dios por todas las agencias que trabajan en la traducción de la Biblia, la educación teológica, los medios masivos de comunicación, la literatura cristiana, la evangelización, las misiones, la renovación de la iglesia y otros campos especializados. Ellas también deben empeñarse en una autocrítica constante, a fin de evaluar su efectividad como parte de la misión de la Iglesia. Rom. 1:18; Fil. 1:5; 4:15; Hech. 13:1-3; 1 tes. 1:6-8.

    9. LA URGENCIA DE LA TAREA DE EVANGELIZACIÓN
    Más de 2700 millones de personas, es decir, más de las dos terceras partes de la humanidad, no han sido evangelizadas todavía. Nos avergonzamos de que tantas personas hayan sido descuidadas; esto es un continuo reproche para nosotros y para toda la iglesia. Hoy, sin embargo, hay muchas partes del mundo en que hay una receptividad sin precedentes frente al Señor Jesucristo. Estamos convencidos, de que es el momento en que las iglesias y las agencias paraeclesiásticas oren fervientemente, por la salvación de los inconversos, e inicien nuevos esfuerzos para realizar la evangelización del mundo. Una reducción del número de misioneros y de fondos procedentes del exterior, puede ser a veces necesario para facilitar, en un país evangelizado, el crecimiento de una iglesia nacional en autoconfianza, y para desplazar recursos a otras áreas no evangelizadas. Debe haber un libre intercambio de misioneros, de todos los continentes a todos los continentes, en un espíritu de servicio humilde. La meta debe ser, por todos los medios disponibles y en el más corto plazo posible, que toda persona tenga la oportunidad de escuchar, entender y recibir la Buena Nueva. No podemos esperar alcanzar esta meta sin sacrificio. Todos nos sentimos sacudidos por la pobreza de millones de personas y perturbados por las injusticias que la causan. Los que vivimos en situaciones de riqueza aceptamos nuestro deber de desarrollar un estilo de vida simple a fin de contribuir más generosamente tanto a la ayuda material como a la evangelización. Jua 9:4; Mat. 9:36-38; Rom. 9:1–9; 1 Cor. 9:19-23; Mat. 16:15; Isa. 58:6,7; Sant. 1:27; 2:1-9; Mat. 25:31-46; Hech. 2:44,45; 4:34,35.

    10. EVANGELIZACIÓN Y CULTURA
    El desarrollo de la estrategia para la evangelización mundial requiere imaginación en el uso de métodos. Con la ayuda de Dios, el resultado será el surgimiento de iglesias enraizadas en Cristo y estrechamente vinculadas a su cultura. La cultura siempre debe ser probada y juzgada por las Escrituras. Puesto que el hombre es una criatura de Dios, algunos de los elementos de su cultura son ricos en belleza y bondad. Pero debido a la caída, toda su cultura está mancillada por el pecado y algunos de sus aspectos son demoníacos. El evangelio no presupone la superioridad de una cultura sobre otras, sino que evalúa a todas las culturas según sus propios criterios de verdad y justicia, e insiste en principios morales absolutos en cada cultura. Las misiones, con mucha frecuencia, ha exportado una cultura extraña junto con el Evangelio, y las iglesias han estado más esclavizadas a la cultura que sometidas a las Escrituras. Los evangelistas de Cristo deben tratar, humildemente, de vaciarse de todo, excepto de su autenticidad personal, a fin de ser siervos de los demás, y las iglesias deben tratar de transformar y enriquecer su cultura, todo para la gloria de Dios. Mar. 7:8,9,13; Gén. 4:21,22; 1 Cor. 9:19-23; Fil. 2:5-7; 2 Cor. 4:5

    11. EDUCACIÓN Y LIDERAZGO
    Confesamos que, a veces, hemos buscado un crecimiento de la Iglesia a expensas de la profundidad, y hemos divorciado la evangelización del crecimiento cristiano. Reconocemos también que algunas de nuestras misiones han sido lentas en cuanto a equipar y animar a los líderes nacionales para que asuman las responsabilidades a que tienen derecho. Sin embargo, aceptamos los principios de autocrítica y anhelamos que cada iglesia tenga líderes nacionales que manifiesten un estilo cristiano de liderazgo, no en términos de dominio, sino de servicio. Reconocemos que hay mucha necesidad de mejorar la educación teológica, esencialmente para los líderes de la iglesia. En cada nación y cultura debe haber un programa efectivo de entrenamiento para pastores y laicos, en doctrina, discipulado, evangelización, crecimiento y servicio. Tales programas de entrenamiento no deben depender de una metodología estereotipada, sino que deben desarrollarse según iniciativas locales creadoras en conformidad con las normas bíblicas. Col. 1:27,28; Hechos 14:23; Tito 1:5,9; Mar. 10:42-45; Ef. 4:11,12

    12. CONFLICTO ESPIRITUAL
    Creemos que estamos empeñados en una constante batalla espiritual contra los principados y potestades del mal, que tratan de destruir a la iglesia y frustrar su tarea de evangelización mundial. Conocemos nuestra necesidad de tomar toda la armadura de Dios y pelear esta batalla con las armas espirituales de la verdad y la oración, ya que percibimos la actividad de nuestro enemigo, no sólo en las falsas ideologías fuera de la Iglesia, sino también dentro de ellas, en los evangelios falsos que tergiversan las Escrituras y colocan al hombre en el lugar de Dios. Necesitamos vigilancia y discernimiento para salvaguardar el Evangelio Bíblico. Reconocemos que nosotros mismos no estamos inmunes a la mundanalidad en el pensamiento y en la acción, es decir, una contemporización con el secularismo. Por ejemplo, aunque los estudios del crecimiento de la Iglesia, tanto numérico como espiritual, tienen su lugar cuando se hacen con cuidado, a veces los hemos descuidado. Otras veces, en el deseo de asegurar una respuesta al evangelio, hemos acomodado nuestro mensaje, hemos manipulado a nuestros oyentes por medio de técnicas de presión y nos hemos preocupado demasiado de las estadísticas y hasta hemos sido deshonestos en el uso que hemos hecho de ellas. Todo esto es mundanal. La Iglesia debe estar en el mundo, pero el mundo no debe estar en la Iglesia. Ef. 6:12; 2 Cor. 4:3,6; Ef. 6:11, 13-18; 2 Cor. 10:3-5; 1 Juan 2:18-25; 4:1-3; Gál. 1:6-8; 2 Cor. 2:17; 4:2; Juan 17:5

    13. LIBERTAD Y PERSECUCIÓN
    Es un deber señalado por Dios, que todo gobierno debe asegurar condiciones de paz, justicia y libertad, en las cuales la Iglesia pueda obedecer a Dios, servir al Señor Jesucristo, y predicar el Evangelio sin impedimento. Por lo tanto, oramos por los gobiernos nacionales y les hacemos un llamado para que garanticen la libertad de pensamiento y de conciencia, y la libertad de practicar y propagar la religión, de acuerdo con la voluntad de Dios en los términos establecidos en la Declaración Universal de los Derechos humanos. Expresamos también nuestra preocupación profunda por quienes sufren prisión injustamente, y especialmente por nuestros hermanos que sufren por el testimonio del Señor Jesús. Prometemos orar y trabajar por su libertad. Al mismo tiempo que no nos dejaremos intimidar por lo que les suceda a ellos. Con la ayuda de Dios, también nosotros procuraremos mantenernos firmes contra la injusticia y permanecer fieles al Evangelio cualquiera sea el costo. No olvidemos la advertencia de Jesús de que la persecución es inevitable. 1 Tim. 1:1-4; Hech. 4:19; 5:29; Col. 3:24; Heb. 13:1-3; Luc. 4:18; Gál. 5:11; 6:12; Mat. 5:10-12; Juan 15:18-21

    14. EL PODER DEL ESPÍRITU SANTO
    Creemos en el poder del Espíritu Santo. El Padre envió a Su Espíritu para dar testimonio de Su Hijo; sin el testimonio de ÉL nuestro testimonio es vano. La convicción de pecado, la fe en Cristo, el nuevo nacimiento y el crecimiento cristiano, son todos obra Suya. Más aún, el Espíritu Santo es un Espíritu misionero, y por ello la evangelización debiera brotar de una iglesia que está llena del Espíritu. La evangelización mundial será una posibilidad realista, sólo cuando el Espíritu renueve a la Iglesia en sabiduría, fe, santidad, amor y poder. Por lo tanto, hacemos un llamado a todos los cristianos, para que oren, a fin de que venga una visitación del Espíritu de Dios, de modo que todo Su fruto se vea en Su pueblo, y que todos Sus dones enriquezcan al cuerpo de Cristo. Sólo entonces, la Iglesia toda llegará a ser instrumento adecuado en Sus manos, para que el mundo entero oiga la voz de Dios. 1 Cor. 2:4; Juan 15:26,27; 16:8-11; 1 Cor. 12:3; Juan 3:6-8; 2 Cor. 3:18; Juan 7:37-39; 1 Tes 5:19; Hech. 1:8; Sal. 85:4-7; 67:1-3; Gál. 5:22,23; 1 Cor. 12:4-31; Rom. 12:3-8

    15. LA SEGUNDA VENIDA DE CRISTO
    Creemos que el Señor Jesucristo regresará en forma personal y visible, en poder y gloria, para consumar Su salvación y Su Juicio. Esta promesa de Su venida, nos impulsa poderosamente a evangelizar, porque recordamos Sus palabras que es necesario que el Evangelio sea predicado a todas las naciones. Creemos que en el período que media entre la ascensión de Cristo y Su segunda venida, la misión del pueblo de Dios tendrá que completarse y que no podemos detenernos antes del fin. También recordamos Su advertencia de que surgirán falsos profetas y falso cristos como precursores del Anticristo final. Por lo tanto, rechazamos todo sueño autosuficiente y arrogante de que el hombre podrá construir una utopía en la tierra. Nuestra confianza cristiana es que Dios perfeccionará Su reino, y esperamos con gran expectativa el día en que habrá nuevos cielos y nueva tierra, en los cuales morará la justicia y Dios reinará para siempre. Entre tanto, nos dedicamos de nuevo al servicio de Cristo y de los hombres, sometiéndonos gozosamente a Su autoridad sobre la totalidad de nuestras vidas. Mar. 14:62; Heb. 9:28; Mar. 13:10; Hech.1:8-11; Mat. 28:20; Mar. 13:21-23; Juan 2;18; 4:1-3; Luc. 12:32; Apoc. 21:1-5; 2 Pedro 3:13; Mat. 28:18

    CONCLUSIÓN
    Por tanto, teniendo en cuenta nuestra fe y nuestra resolución, hacemos pacto solemne con Dios y con nuestros hermanos, de orar, planear y trabajar juntos para la evangelización de todo el mundo. Hacemos un llamado a cuantos quieran unirse a nosotros. QUE DIOS NOS AYUDE POR SU GRACIA Y PARA SU GLORIA A SER FIELES A ESTE PACTO! Amen, Aleluya.

    Fuente:http://www.comimex.org/08_lausana.shtml